A practical reference on NAD+ biosynthesis: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-05-07. Anything still debated is marked as such rather than presented as settled.
Two enzymatic steps define the canonical route from nicotinamide to NAD+. Nicotinamide phosphoribosyltransferase, known as NAMPT, produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN adenylyltransferases, or NMNAT enzymes, then couple NMN with ATP to form NAD+. Whether intact NMN crosses cell membranes efficiently remains an active area of investigation; some studies propose direct transport, while others emphasize extracellular dephosphorylation to nicotinamide riboside followed by uptake. The relative contribution of each route likely depends on cell type, tissue, and experimental conditions.
Trace amounts of NMN have been reported in certain plant foods, including edamame, avocado, broccoli, cucumber, and cabbage. Reported concentrations vary widely because analytical methods differ and food matrices complicate extraction. Endogenous production in cells is generally considered more quantitatively important than dietary intake, though precise human turnover rates are difficult to establish. Commercial NMN for research or consumer products is commonly made through enzymatic synthesis or chemical phosphorylation routes. Regulatory classification differs by country; in some jurisdictions NMN is sold as a supplement, while in others it is treated as a novel food ingredient or restricted substance.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C11H15N2O8P | Canonical beta anomer; charge state depends on pH. |
| Molar mass | 334.22 g/mol | Calculated for the neutral formula. |
| CAS Registry Number | 1094-61-7 | Common identifier for beta-nicotinamide mononucleotide. |
| Appearance | White to off-white powder or crystals | Varies with purity, hydration, and polymorphism. |
| Solubility | Freely soluble in water; low solubility in nonpolar solvents | Reported values depend on salt form and temperature. |
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
Research on NMN has expanded because NAD+ concentrations decline with age in some tissues and because NAD+ participates in energy metabolism, DNA repair, and signaling. Animal studies have reported changes in NAD+ levels after NMN administration, but human data are more limited and often focus on safety, pharmacokinetics, and biomarker changes. Questions remain about oral absorption, tissue distribution, and whether changes in blood NAD+ reflect changes inside specific organs. NMN is not an approved drug, and claims about its clinical effects should be distinguished from established biochemical findings.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms. Its structure consists of a nicotinamide group linked to a ribose sugar that carries a phosphate group. NMN is an intermediate in the biosynthesis of nicotinamide adenine dinucleotide, or NAD+, a coenzyme involved in many metabolic reactions. The abbreviation usually refers to the beta anomer, though related forms can exist. In scientific literature, NMN is distinct from nicotinamide riboside, another NAD+ precursor.
In the NAD+ salvage pathway, the enzyme NAMPT converts nicotinamide and a phosphate-donor molecule into NMN. A second enzyme, NMNAT, then converts NMN into NAD+. Nicotinamide riboside can also enter this route after being converted to NMN by nicotinamide riboside kinases. Because NMN sits at a junction between precursor uptake and NAD+ formation, its cellular concentration is tightly linked to enzyme activity and tissue type. NAD+ participates in redox reactions, signaling, and DNA repair, and its levels decline with age in some animal models, though human evidence remains more limited and context-dependent.
In terms of dosage equivalence, norethisterone and NETA are typically used at respective dosages of 0.35 mg/day and 0.6 mg/day as progestogen-only contraceptives, and at respective dosages of 0.5–1 mg/day and 1–1.5 mg/day in combination with ethinylestradiol in combined oral contraceptives. Conversely, the two drugs have been used at about the same dosages in menopausal hormone therapy for the treatment of menopausal symptoms. NETA is of about 12% higher molecular weight than norethisterone due to the presence of its C17β acetate ester. Micronization of NETA has been found to increase its potency by several-fold in animals and women. The endometrial transformation dosage of micronized NETA per cycle is 12 to 14 mg, whereas that for non-micronized NETA is 30 to 60 mg.
Chlorella vulgaris is a species of green microalga in the division Chlorophyta. This unicellular alga was discovered in 1890 by Martinus Willem Beijerinck as the first microalga with a well-defined nucleus. It is the type species of the genus Chlorella. It is found in freshwater and terrestrial habitats, and has a cosmopolitan distribution. Chlorella vulgaris has a number of potential applications in science, such as biofuel, livestock feed, and wastewater treatment. Beginning in the 1990s, German scientists noticed the high protein content of C. vulgaris and began to consider it as a new food source. Japan is currently the largest consumer of Chlorella, both for nutritional and therapeutic purposes, and it is used as a dietary supplement or protein-rich food additive in several countries worldwide. C. vulgaris is a green eukaryotic microalga. The cells are 4–10 μm in diameter, and are spherical. The chloroplast (chromatophore) is pea-green in color and cup-shaped, with a single pyrenoid.
In cancer cells, an increase in Akt signaling correlates with an increase in glucose metabolism, compared to normal cells. Cancer cells favour glycolysis for energy production over mitochondrial oxidative phosphorylation, even when oxygen supply is not limited. This is known as the Warburg effect, or aerobic glycolysis. Akt affects glucose metabolism by increasing translocation of glucose transporters GLUT1 and GLUT4 to the plasma membrane, increasing hexokinase expression and phosphorylating GSK3 which stimulates glycogen synthesis. It also activates glycolysis enzymes indirectly, via HIF transcription factors and phosphorylation of phosphofructokinase-2 (PFK2) which activates phosphofructokinase-1 (PFK1). Protein kinase B PI3K/AKT/mTOR pathway Signal transduction KEGG Pathway: PI3K-Akt signaling pathway CST: PI3K/Akt Signaling Resources
Sources: en.wikipedia.org
The first few amino acids were discovered in the early 1800s. In 1806, French chemists Louis-Nicolas Vauquelin and Pierre Jean Robiquet isolated a compound from asparagus that was subsequently named asparagine, the first amino acid to be discovered. Cystine was discovered in 1810, although its monomer, cysteine, remained undiscovered until 1884. Glycine and leucine were discovered in 1820. The last of the 20 common amino acids to be discovered was threonine in 1935 by William Cumming Rose, who also determined the essential amino acids and established the minimum daily requirements of all amino acids for optimal growth. The unity of the chemical category was recognized by Wurtz in 1865, but he gave no particular name to it. The first use of the term "amino acid" in the English language dates from 1898, while the German term, Aminosäure, was used earlier. Proteins were found to yield amino acids after enzymatic digestion or acid hydrolysis. In 1902, Emil Fischer and Franz Hofmeister independently proposed that proteins are formed from many amino acids, whereby bonds are formed between the amino group of one amino acid with the carboxyl group of another, resulting in a linear structure that Fischer termed "peptide".
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
== The Human Growth Hormone, Creutzfeld Jakob Disease Controversy == Wilhelmi was an important researcher involved in harnessing human grown hormone from cadavers in the 1960s and 1970s. Early studies conducted in 1958 by Maurice Raben at Tufts University School of Medicine showed it was possible to cause children with pituitary dwarfism to grow by injecting them with human growth hormone. In 1961, the National Institutes of Health (NIH) formed the National Pituitary Agency to organize collection and redistribution of human endocrine glands to three universities for processing into growth hormone: Emory University, Tufts University and Cornell University. For the first 14 of these years, Wilhelmi supervised the Emory laboratory, which was the largest seat of hormone production. In 1985, however, two patients who previously had received the exogenous hormone treatment died in the United States. That caused the NIH to suspend the human growth hormone program and launch an investigation. The deaths were attributed to Creutzfeldt–Jakob disease (CJD) transmitted by impurities in the hormone injected into the patients years earlier using the Wilhelmi protocol. As of 2000, there had been 22 CJD deaths among American recipients of unfiltered hormone prior to 1977.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ metabolism. It occurs naturally in cells and can also be produced synthetically for research or commercial use. Its name reflects its composition: nicotinamide, ribose, and a phosphate group.
NMN is a direct precursor in the NAD+ salvage pathway. NMNAT enzymes convert NMN and ATP into NAD+, a coenzyme used in many cellular reactions. This relationship makes NMN a focus of studies on NAD+ metabolism.
Small amounts of NMN have been reported in some plant foods, but measured levels vary and are not consistently quantified. Dietary contribution is generally considered minor compared with endogenous production. Food-matrix effects make accurate analysis difficult.
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide and an intermediate in NAD+ biosynthesis.